Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)
Average proteome isoelectric point is 6.72
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 73 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q914H8|Y054_SIFVH Uncharacterized protein 54
MSNMSSTSTSVTQPAYTEAFMSAIATSVTGVNVSQYPSPSGYHVYLSSQTGIVDNTTDVSVYNVSDTYQNNNEVTSVTFIAIFKNLSSYTFSEILFYTQVNGQDFMQVAQFIPSSAIQKSSGYALVIMITLSIATPVYIIDAIQDVQQLCTNYCINVNCNAVGGNIETSYLPFSLFNLVFLYLLGVNTNT
VEQSPSTQQTASEYANCINSCVQYCGTNTGLECIACLSSCRTYLLENPLFTFLLANNIQNVMELLPQGINTIYTVNVCSGKVATLTPQNFQNNLNVVSQSEIQYTIQFYLPGTNELFNALQIMISTLNTNYNYSLGVLYFTGVPLPSGETFILEVTVSES
Molecular weight: 38.33 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q914I3|Y049_SIFVH Putative transmembrane protein 49
MVRALLFHVITYTKFIVPVVKLLIMSAIAGVIAGAFGGGIGGVGDAIGTIIGDLERAIARFGGSIVNAFKTVIDKILTLAVRIGRIIEKYFRIAVHYIVLFLRLAYRYMYSFYTEFQKDPWRSLQFVGSMAILLNNSLFP
Molecular weight: 15.55 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
73 |
0 |
73 |
12,208 |
31 |
601 |
167.2 |
19.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.6 |
1.2 |
4.48 |
6.87 |
4.55 |
4.72 |
1.47 |
9.47 |
7.83 |
9.09 |
2.53 |
6.18 |
3.27 |
3.41 |
3.53 |
6.76 |
6.18 |
7.3 |
0.84 |
5.73 |
Note: For statistics only major isoforms were used (in this case 73 proteins)
For dipeptide frequency statistics click
here