Acidocella sp. MX-AZ02
Average proteome isoelectric point is 6.86
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,506 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K5ZJZ3|K5ZJZ3_9PROT Filamentous hemagglutinin outer membrane protein (Fragment)
LTGSIGGDAVLSNGGNTIGTLADFSAGGTLALTDTGALSQTGSVSASAVTLSATAMTLSGNVSASSALELASGGTLVQSGSLTGTDISLSGSSLGLNGSITATTATLAATGAINQAGSAGLAAASLTGSAGASIALGGTNSIATLSTLSAGGNIALNDAQSLTLAGLVTTPGTLTLTDGKAVGESAGSLV
VGGLAGSIGGGLTLGGANSIATLASMSAGGDMLIANIGTITLNGPVSAGTSLALVTAGLLEGTGGSLAAGTIAIAPYNAGTLDLGGTAVAGLQLAQALVSTFDSHAVVIIGAANGVQASSIYSEG
Molecular weight: 28.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K5YYZ6|K5YYZ6_9PROT Uncharacterized protein
MIFVLSNRVPVQIGFWPFGSASAWLGPVAVVALAIGFFVGLLVALPRQLHWRRRARQAEKRVVELTPPAPAVPVTQPTIIR
Molecular weight: 8.94 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,476 |
30 |
3,506 |
1,050,941 |
25 |
1,979 |
302.3 |
32.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.93 |
0.9 |
4.84 |
5.24 |
3.66 |
8.87 |
2.11 |
5.03 |
3.11 |
11.16 |
2.42 |
2.65 |
3.67 |
5.5 |
6.43 |
5.1 |
5.06 |
6.77 |
1.33 |
2.2 |
Note: For statistics only major isoforms were used (in this case 3,476 proteins)
For dipeptide frequency statistics click
here