Microgenomates group bacterium GW2011_GWA2_47_8
Average proteome isoelectric point is 7.8
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 782 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1VW29|A0A0G1VW29_9BACT Uncharacterized protein
MTLKKQIISIIASGAVLLQATIPAFADTTLVISGNGADSKNEVKIESNQSTLVTQNNDAKINNQVNASSDTGDNEAEENTGGDVSISTGDATTDVNVQNTVNSNAASVDCCGNNDVDVLISGNGADSDNKVELKDEKDSGVQVFQDNNADVKNHVDADSNSGDNEAEENTGGDVSIETGDASTTVGVSTT
ANANWAQVGGNGSNPTLSLRIVDNGADTKNKIKLDLDGGVLLTQNNDAKVVNDVDADADTGDNEAEENTGGDVSIETGDATVDVTVDNMVNFNWADVDCGCLFDLLAKIEGNGVDSDNKLEAKLGGDLEVFQDNVADKLKNDVDADADSGDNEAEENTGDVEGSDPSIVTGDADTTVEVGNAGNSNSYGA
DVPADFPEVGFNFNVSLSWAQLMALLGL
Molecular weight: 42.06 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1TM62|A0A0G1TM62_9BACT 50S ribosomal protein L35
MGKVKTKKIVTKRFHVSKTGKLMHRAQGARHLRRRKNKSRQRRQDKPVELTNMRFMSVIKQYLSA
Molecular weight: 7.78 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
777 |
5 |
782 |
220,842 |
23 |
1,497 |
284.2 |
31.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.69 |
0.69 |
4.77 |
5.27 |
4.88 |
7.13 |
2.08 |
7.19 |
6.09 |
10.43 |
2.22 |
3.42 |
3.33 |
4.48 |
5.41 |
6.29 |
6.06 |
7.66 |
1.38 |
3.53 |
Note: For statistics only major isoforms were used (in this case 777 proteins)
For dipeptide frequency statistics click
here