candidate division Zixibacteria bacterium SM23_81
Average proteome isoelectric point is 6.85
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,297 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S8K7Z3|A0A0S8K7Z3_9BACT Uncharacterized protein (Fragment)
TDPDVGDSALLVVDLDYSDNAGGSWASIETGESNDGAYFWDISGLSDGTNYLVRVIVTDTSGLFDSDTSDAIFSIDNPDDPTVTVTYPNGGETLSDSVMVTWTATDPDVGDSALLVVDLDYSDNGGGSWESINTGEVNDGVYSWDISGLLDGSGYLVRVTVTDTSGLFDSDTSDAVFSIDNPDDPTVTVT
YPNGGETLSDSVMVTWLATDPDVGDSALLVVDLDYSDNAGGSWTSIETGESNDGAYFWDISGLSDGSDYLVRVIVTDTTGRSDLDVSDGTFSVDNPDAPTVSVTYPNGGETLSDSVMVTWTATDPDVGDSALLVVDLDYSDNAGGSWESINTGEVNDGVYSWDISGLSDGSGYLLRVTVTDTSGLFDSDT
SDAIFTIDNPDAPSVTVIYPNGAETLSDSAVITWLATDPDVGDSALLVVDLDYSDNGGGSWMPISTGESNDGSHFWDVSELSDGTNYLVRVTVTDTTGLFDVDTSDAVFIIDNPEPPAAISDLTVVLTDGSIRLSWTAITEDTLGMPIVVEYYNVYRNVDPYFSSGPADSIGSTTGTFYLDPTPALKDTS
VNHYYLVQAVSLQRRKSADSNRVGEFDRNMTDIEPSGPPKNRR
Molecular weight: 64.97 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S8KC38|A0A0S8KC38_9BACT Uncharacterized protein
MIFSPRPRRREFTLRSRKKAAEGKRGGLNFRRPHRRLPARGANLLWLIILLILVIFLMRYFRSLNW
Molecular weight: 8.03 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,274 |
23 |
2,297 |
770,550 |
30 |
4,574 |
338.9 |
37.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.99 |
1.09 |
5.44 |
6.61 |
4.15 |
8.15 |
2.15 |
6.11 |
4.81 |
10.38 |
2.35 |
3.11 |
3.82 |
4.44 |
6.22 |
5.99 |
5.05 |
7.51 |
1.37 |
3.25 |
Note: For statistics only major isoforms were used (in this case 2,274 proteins)
For dipeptide frequency statistics click
here