Syntrophobacter sp. DG_60
Average proteome isoelectric point is 7.63
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,273 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S7XVK8|A0A0S7XVK8_9DELT Uncharacterized protein
MLKTLKAIFLNTSLTFLFILFLINMAGAADFCVSNAADPQSALTTAASNGEDDVIKIVQGTYIGNFIYSSCEDYDLTIEGGYSEGCTSRVVDPANTVLDGGASGTVLVLSTDKEANFSIDGVTLKNGMTDKCGGGLYAYASGTITLTNNTITGNSAGCGGGLRADAETITLTNNTIRANSAVSGGGLCLP
AYYVLGTVTLTNNTITGNSAENGGGAYISLYYDSAIAKIYNNIIWNNTAINEGNDLYIDNDRNNNYLASYVNLFNNDFDQSIEGIYIEIPFTIDPTNLNNEDPLFVDPANNDYRLQAGSPCIDAGDPNAPELPAADFERDPRIEGAAPDIGADEYYTGPPVPIPDIKVNGSDGPITLGQSDILTVSVLLD
NNDITENADWWLAADTPFGLYFYTFDGWTTDWVPAYQGHLFYLDSFEVLKNMPVSRLPAGTYTLYFGVDTVMDGNVTWDSGYYDTVVVNITE
Molecular weight: 50.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S7XT74|A0A0S7XT74_9DELT 50S ribosomal protein L34
MKRTYQPHIKRGKRVHGFLARMATKAGRRIINRRRAKGKKRLTVFN
Molecular weight: 5.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,259 |
14 |
1,273 |
348,853 |
29 |
1,367 |
277.1 |
31.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.75 |
1.33 |
4.59 |
7.05 |
4.71 |
7.03 |
2.11 |
8.89 |
8.17 |
10.48 |
2.22 |
3.67 |
2.73 |
4.31 |
5.01 |
5.31 |
4.57 |
6.33 |
1.09 |
3.67 |
Note: For statistics only major isoforms were used (in this case 1,259 proteins)
For dipeptide frequency statistics click
here