Leptolyngbya sp. Heron Island J
Average proteome isoelectric point is 6.15
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 7,108 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|U9VTQ3|U9VTQ3_9CYAN Uncharacterized protein
MDANVLSLFNQPLAIANDSSADPLGAFVALLPNIDFDSLIADITDIVNDEIADVDQVVDSTTSLVVETLTNLGVDIETVDVSDVVEDIVNFIAELPEDATIADVLSDVVDFFEVTLPSLSDDELLELLTDVNDLISEIAPNLSQLSITPFLEQGVDFVEDLIDSTGTITIDGPNLSGELTQDGITRSFTI
GLDDAFDDLLEDASDFLAGITGSASLSDGQFTGDVTIDGNDYALSLDITEALTDNLTSLFTSADVTLPFANGILNVDIDTALGDFVGTIDFAGGDLDLDLTTPFGDLDTSIEFPEDAQFELPDDMLSGVDAELDLSAGVVRVPISSVLLALPLEAFSGELSLSEGLGSFTAGFDGLPIDDFSTTFEVGPL
ASQLASALTEDLSGELTIDAGEIAGNIVSDFGEFEVAASFDDLILRASSVIDSTTGALTLQDGIASINLDTSLGQLSGAIALSTVEDVLTNASNLLA
Molecular weight: 49.71 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|U9W587|U9W587_9CYAN Uncharacterized protein
MGYILAMIRVAIARSKLVQRVPKTNSKGPRTQPTVRHSSRLSILKVFLMNMKASLTKQVQLTLHMK
Molecular weight: 7.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7,040 |
68 |
7,108 |
2,208,812 |
29 |
4,624 |
313.8 |
34.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.96 |
0.97 |
5.49 |
5.82 |
3.81 |
6.87 |
2.06 |
6.0 |
3.66 |
11.25 |
2.0 |
3.73 |
5.53 |
4.87 |
5.42 |
6.38 |
5.97 |
6.79 |
1.52 |
2.9 |
Note: For statistics only major isoforms were used (in this case 7,040 proteins)
For dipeptide frequency statistics click
here