Virtual 2D-PAGE plot for 53,104 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|M1D9W0|M1D9W0_SOLTU Uncharacterized protein
MIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIE TQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQTDLNPGATNDSLMIETQAQIQIVQ
Molecular weight: 30.23 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|M1DM65|M1DM65_SOLTU Uncharacterized protein
MKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMKQLLQAHVNANNRMTLLLRSLPHHSPQS
Molecular weight: 21.14 kDa Isoelectric point according different methods: