Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens) (Trichoderma virens)
Average proteome isoelectric point is 6.46
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 12,389 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G9N1B2|G9N1B2_HYPVG Uncharacterized protein (Fragment)
MAGAWDNHQTVNWDEPANWDHLQPSSDVKVDQTITVREDEATDIAISSDTVDTPYQDSPEPALEAFSIEPVTEEIERDSGSTAAQAQDDSFIASEQAAPAEQTTPAEQTTPAEQTTPAEQTTPAEQTTPAEQDAPAEQTTPAEQDAPAEQTTPAEQDALSEQTHGDAFTPAEQDAPAEQDAPAEQTTPAE
QTTPAEQDAPAEQTTPAEQDAPSEQTHGDAFTPAEQDAPA
Molecular weight: 24.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G9MDN7|G9MDN7_HYPVG Uncharacterized protein
MPFTTHRRHHHTTTTTTARPYRRSIFSRRAPRVHHQRKPTLKDKVSGALTRLRGSLTRRPGVKAAGIRRMRGTDGRGSHRRRRFF
Molecular weight: 10.01 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
12,381 |
8 |
12,389 |
5,833,200 |
44 |
20,891 |
471.1 |
52.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.68 |
1.29 |
5.76 |
6.09 |
3.82 |
6.79 |
2.36 |
5.29 |
4.91 |
9.09 |
2.23 |
3.77 |
4.04 |
5.71 |
5.86 |
8.09 |
5.78 |
6.09 |
1.53 |
2.82 |
Note: For statistics only major isoforms were used (in this case 12,381 proteins)
For dipeptide frequency statistics click
here