Streptococcus sp. oral taxon 056 str. F0418
Average proteome isoelectric point is 6.45
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,957 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F9HEH5|F9HEH5_9STRE Uncharacterized protein
MLSELLIDIEVLVLTEAELDALIDADSLALTDALVLADTELLTDAEVLVLTDAELDALIDAEVLALTDALVLALTDAELDALTDAEVLALTEAELDALTDAELDALTDAEVLALTDALVLADTELLTDAEVLALTEAELDALTDAELDALTDAEVLALTDAEVLALTDAELDALTDAEVLVLTEAELDAL
IDAEVLALTDALVLALTDAELDALTDAEVLALTEAELDALTDAEVLALTDAEVLALTDAELDALTDAEVLALTEAELDALTDALVLADTELLTDAEVLALTDAELDALTDAEVLALTDAELDALTDALVLADTELLTDAEVLALTDAELDALTDAEVLALTDAELDALTDAEVLVLTDALVLADTELLTD
AEVLVLTEAELDALIDAEVLALTDALVLALTDAELDALTDAEVLALTEAELDALTDALVLADTELLTDAEVLALTDAELDALTDAEVLALTDALVLADTELLTDAEVLALTEAELDALD
Molecular weight: 51.71 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F9HFR0|F9HFR0_9STRE 50S ribosomal protein L34
MKRTYQPSKIRRARKHGFRNRMSTKNGRRVLAARRRKGRKVLAA
Molecular weight: 5.27 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,948 |
9 |
1,957 |
558,140 |
37 |
3,829 |
286.5 |
32.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.44 |
0.56 |
5.52 |
7.04 |
4.72 |
6.44 |
1.94 |
7.35 |
6.77 |
10.25 |
2.5 |
4.41 |
4.21 |
3.25 |
4.1 |
6.39 |
5.51 |
6.85 |
0.91 |
3.85 |
Note: For statistics only major isoforms were used (in this case 1,948 proteins)
For dipeptide frequency statistics click
here