Virtual 2D-PAGE plot for 5,073 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|C4R7M6|C4R7M6_PICPG Uncharacterized protein
MLTTILALAFFRALVLADSVEFYIYVWQPGFGVEDAYWGVDESGLITAVGPGYVSDDIPQVLFVVTTDGKLQGNGQLVEITPPYDFLTLRQNNTGTSGFSIDYDDIPTLLLNGAAIDHVWSCLSPDGDHGFVISSDSPNASCSGFTVRISLQQEPGPCEGDECTEPPEPPVCSDDDDECTEPPEPPVCSD DDDECTEPPEPPVCSDDDDECTEPPEPPVCPDDDDECPEPPTDTTDETPTETPTETPTETPTETPTETPTETPTETPTETAYPPTLPTDTTLTTAPTSTSSEVSTPSPSPSVGDANVIVNTLGLTGLIAVVAMVLLA
Molecular weight: 34.68 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|C4R4N6|C4R4N6_PICPG Uncharacterized protein
MLRVVNQKMASNVASGMYRANGNMFRTLGQIMQRPQLANPTNIQSQSLVQEVSPLSFINNFVGSFSQRRWGTRGGNRGNTYQPSTLKRKRRLGFLARMRSISGRKVIRRRQLKGRWYLSH
Molecular weight: 13.86 kDa Isoelectric point according different methods: