Proteome-pI - Proteome Isoelectric Point Database statistics

Average proteome isoelectric point is 7.33

Acidic

pI < 6.8

6.8-7.4

pI > 7.4

Basic

All

* You can choose from 18 different methods for calculating isoelectric point

Protein with the lowest isoelectric point:

>tr|B1ZSW6|B1ZSW6_OPITP Uncharacterized protein 

MNLDDLMAEGELALSVDGDDGVIRLKARATFDEPVELSADAARELAQRLIELADEIG

Molecular weight: 6.14 kDa
Isoelectric point according different methods:

Protein with the highest isoelectric point:

>tr|B1ZTT5|B1ZTT5_OPITP Uncharacterized protein 

MLVGLRVRGPFRARSMPPRRLAAETVALAPAAAATAASALSLFVPAAMGLAGRLRTAVRSAGLRRLATSVRGAWFVARRAVGFGR

Molecular weight: 8.86 kDa
Isoelectric point according different methods:

Number of major isoforms	Number of additional isoforms	Number of all proteins	Number of amino acids	Min. Seq. Length	Max. Seq. Length	Avg. Seq. Length	Avg. Mol. Weight
4,561	27	4,588	1,738,393	32	14,944	381.1	41.6 kDa

Ala	Cys	Asp	Glu	Phe	Gly	His	Ile	Lys	Leu	Met	Asn	Gln	Pro	Arg	Ser	Thr	Val	Trp	Tyr
12.47	0.89	5.06	5.54	3.96	8.01	2.19	4.33	2.96	10.53	1.79	2.8	3.49	5.62	7.6	5.37	5.82	7.56	1.62	2.37

Note: For statistics only major isoforms were used (in this case 4,561 proteins)
For dipeptide frequency statistics click here

See this proteome in:

Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here

Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978

Contact: Lukasz P. Kozlowski