Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Average proteome isoelectric point is 6.98
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,828 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A5MZZ3|A5MZZ3_CLOK5 Uncharacterized protein
MPVIQVNPSDDAYISQLNPNTNFSNSSLLFTGEFVQPNDVFRSLLKFDLSNVIPPGSSVLQASLELFVFRKDMPDAVLSPQTVNVFTNASGFSENTVTWNNAPSLNPTTYSVNVTDSDVGNFISIDITDLVGSWIDGSIINNGVTLVGIESAIDTIIGYFSKEWTVPSQRPFLNIEYGTLVPTGITGPTG
PTGDTGPTGPTGDTGATGATGDTGPTGATGETGPTGATGDTGATGATGDTGPTGATGDTGATGATGATGATGDTGATGATGDTGATGATGDTGPTGATGDTGATGATGDTGATGATGDTGPTGATGDTGATGATGDTGATGATGDTGPTGATGDTGATGATGDTGDTGATGDTGPTGATGDTGATGPTGA
TGDTGPTGATGDTGATGATGDTGATGATGDTGPTGATGDTGATGDTGATGATGDTGATGATGATGDTGATGATGDTGPTGSTGDTGATGATGDTGATGATGDTGATGATGDTGATGSTGDTGATGATGDTGPTGATGDTGATGATGDTGATGATGATGDTGPTGATGETGATGVTGDTGPTGPTGETGAT
GPTGPTGPTGATGDTGATGDTGPTGATGDTGPTGPTGDTGPTGATGAAGVGLSSAVQFDPIEAPNYPLDQVVEYNGSLYIVTSVPSSGTPDTSPDYNLLVSAGAAGVTGDTGPTGATGPNVSEEGFSAFISTLDISASTQLTGWTVDSPFFDNTSFDETTGNYTVPETGVYSIKATINYSTTAAISVAIG
AGVNPAFVVRRTSPTTEDLISGLFPVLNIAVVVLTLRGVLGSGTVTLAGEVELNAGDVIGLFYEANGLTIGLDLGGPSTGIVWSVYRLT
Molecular weight: 79.61 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A5N456|RL34_CLOK5 50S ribosomal protein L34
MWMTYQPKKKQRKREHGFRKRMRTLSGRNVIKRRRQKGRKRLTA
Molecular weight: 5.58 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,808 |
20 |
3,828 |
1,104,453 |
30 |
3,072 |
290.0 |
32.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.56 |
1.32 |
5.35 |
7.0 |
4.34 |
6.34 |
1.45 |
9.99 |
9.01 |
8.84 |
2.68 |
6.23 |
2.62 |
2.88 |
3.58 |
6.64 |
4.91 |
6.39 |
0.73 |
4.15 |
Note: For statistics only major isoforms were used (in this case 3,808 proteins)
For dipeptide frequency statistics click
here