Cutthroat trout virus
Average proteome isoelectric point is 7.73
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F5BB18|F5BB18_9VIRU Capsid protein
MADSNAVVPSAQSKPRRTRRPKMDPSQIPDTVKTFRLTTDPIMAPPPGEIDSLLYTSGLSPAVVLSFSSFTSPAVVFAANYEKYKILSFKATVLSLAPEAISSYNLSVVWFPDASEGPTSLQATNLSMVRRYHSILPGQSGSLSLTASELLHGIAEKYVDPTHSDALSAFCGLFMVVCHGAPFNHYRDTQ
YLGPLFKIQFEFKLSVFGYSPGNIPVKVQGASATEIVSFGTVDGKATFDTPSAIALHASYQSGPPNSPGPSIGQVLLTVADTVSAALPFPFSILAKVGLFFIRKITGANGTSFMVYKSYGDAIRNRPLPSRSSHQLGNALVRQTTFGTNDDSVLPPQPISQFTFHFKTGDVLVIQGSFKAPTSRPNNWNV
QEFSISRILNITNGTSTTNILVFEKWTLDGNLPQIKNTYGLIGVHYFPASISPVGTSTFDNIIGDCKVFAGTATDSMLTPGPGSITVTFLSQTRGFLSQTELTQGLIAASSTMDTTDSSLTRQASQPMEVDGFLSGLIPSTPLCNMVNNTFSCGNSDSQATSRSAVHSLGPNCDKCGLDLNLRVTPCIAT
RLQHTPKACPHCSFLLGLTAYTVDCMRPSDTTDSTVDALLNPLNSLDLESESEPSDDDLIQFDD
Molecular weight: 68.01 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F5BB19|F5BB19_9VIRU Phosphoprotein
MGKLPLTPLPQLLSMLHTKVAHQIHPGLLSAKYSSQWLTPCQLRSLSLSVYLQKLVSSLSARLLEPMELPSWSTNPMEMQFATAHYPHAQAINWAMHLSARPHSALTMTQFSHPSPSASSPSTSRLAMSLSSRVPSRPQPVDPIIGMFRNSPFRESLTSLMGPPLQTFLCLKSGLWMVTSHRSRTPTVSS
GSTTSRLPLVLLAPAPSTTSLVIAKSLQAPQLTAC
Molecular weight: 24.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
2,566 |
225 |
1,707 |
855.3 |
94.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.09 |
1.95 |
5.22 |
3.47 |
4.29 |
5.42 |
3.12 |
5.22 |
4.48 |
9.31 |
2.03 |
4.09 |
4.09 |
7.44 |
4.52 |
9.28 |
9.35 |
5.92 |
0.94 |
2.77 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here