Lactobacillus fermentum (strain CECT 5716)
Average proteome isoelectric point is 6.59
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,043 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|D8IIX0|D8IIX0_LACFC Arginase
MAVHFDLDALLPTAFRSIYPAEPGTDPADFPATVGQLTLPEVANLLTQLDQNAELVGLTVAEHMAWDALNLR
Molecular weight: 7.79 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|D8IHI1|D8IHI1_LACFC MFS family major facilitator transporter multidrug :cation symporter
MKDQRIARSLVIMVFGTFFGLLCSTLMNTGLPQLMRVFSVSEGTVQWIINAYMLTNAMMIPLSAYLIRRWSFRTLFIIATAVFLVGTVGGAVAPTFWTVVIARVVQAAGAGIMMPLVNVLAIRYAEPKKKGTIMGIIGLAFNFSPIIGPTVSGLILDDLSWRWLFLVIVPFSVLTLVAAVIQLPRIPHNE
NPHFDTRGMAIVSIGLWALLMGLSNVSTSPFWTWQVLGLLVVGAVALVIFYFSQRGVKAPLINFSVMAYDQFVVATLINMLIVATMFGNTILLPLLVQNVQQKSALVSGLVILPGALVTGFLSRLSGRLYDRLSVRRLVLFGLVVDGAGTLFQATIGAASGPVVLALFQAVRQLGLVSXLIPLQTHALGI
LPFDLVPDGVATFNTIRQVAASLGTAVLVSVVGLMGQWGHRGTLFGIQAGFATCFIFLVAAMMIAGRLKSQFKLGRPTVSAG
Molecular weight: 49.58 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,040 |
3 |
1,043 |
392,348 |
63 |
1,399 |
377.3 |
41.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.0 |
0.55 |
5.72 |
5.52 |
4.05 |
7.15 |
2.25 |
6.02 |
5.58 |
9.91 |
2.63 |
4.27 |
4.64 |
3.95 |
4.66 |
5.49 |
6.27 |
7.58 |
1.12 |
3.55 |
Note: For statistics only major isoforms were used (in this case 1,040 proteins)
For dipeptide frequency statistics click
here