Achromobacter piechaudii ATCC 43553
Average proteome isoelectric point is 7.04
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,755 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|D4XJV3|D4XJV3_9BURK Adenoviral fiber protein (Repeat/shaft region) (Fragment)
DGNAVVVGTPVAVANGMVTLKADGTLDFAPAANYNGSTSFTYTVTSGGVDETATVSVSITPVPDAPMTVDPAVPGQSFDSATGNYATTTTEDTAVTGQVSAVDGDGDPLAYSVGTAPAHGTVTVNASTGAYTYTPTADYYGSDSFVVAIDDGTGNITLSTVKVTVSAVVDIANDSVTTNEDTTVNIDVNA
NDTFENAGHAITAIDGNAIVVGTPVAVANGMVTLKADGTLDFAPAANYNGSTSFTYTVTSGGVDETATVSVSVTPVNDPPVLTDPRVGNQGFDPATNTYTNTTTEDNAVSGLISALDTDGNPLTYSVSTAPVHGAVMLDASTGTYTYTPTADYYGSDSFVVTVSDGFGGTLQATVNMTVSAVVDIANDTV
TTNEDTPVNIDVNANDTFENAGHAITAIDGNAVVVGTPVAVANGMVTLKADGTLDFTPAANYNGSTSFTYTVSSGGADETATVSITVTPVPDAPMTVDPAVPGQTFDSATGNYATTTTEDTAVTGQVSAVDGDGDPLAYSVGTAPAHGTVTVNATTGAFTYTPTADYYGSDSFVVAIDDGTGNVTFSTVS
VTVSAVVDIANDTVTTNEDTPVNINVNANDTFENAGHTITAIDGNAVVVGTPVAVANGMVTLKADGTLDFAPALNYNGSTSFTYTVTSGGVDETATVMVSITAVPD
Molecular weight: 67.76 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|D4XJS0|D4XJS0_9BURK Uncharacterized protein (Fragment)
NAPSRPASLQRSSTMSRTAAAARGSPTTSPRRTRRKMGP
Molecular weight: 4.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,602 |
153 |
5,755 |
1,780,444 |
39 |
9,024 |
317.8 |
34.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.91 |
0.88 |
5.47 |
4.8 |
3.39 |
8.46 |
2.11 |
4.47 |
2.98 |
10.65 |
2.57 |
2.72 |
3.96 |
5.32 |
6.89 |
5.54 |
5.32 |
7.7 |
1.42 |
2.43 |
Note: For statistics only major isoforms were used (in this case 5,602 proteins)
For dipeptide frequency statistics click
here