Virtual 2D-PAGE plot for 2,946 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q8FQC2|Q8FQC2_COREF Uncharacterized protein
MEGHPNMSFFEDIAAALDRDGIESRVNGDTMFVPITSDLEIQFVEIDSLLPAANVYIAAANVDEDDEDFEAVLVSVVFSIDDAVVAVAKHVATDQVVTVLRDLLEGTDERIQDLEFYQDAVNANLVRAEVGQNSELQVLVEVEDGVPTATVSFVAIGETFEDLVDQAIEELWESDGDAVLSEEDRQRMFA DLTGELEFATDEVLDLGTFTDFDRLFDVLSLADDHAEDWEEQLVPFDDEEFDEPDVYDLFVDDSDEDDFEDDDDEDDDEEDDEDDDDPASK
Molecular weight: 31.42 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q8FSG0|Q8FSG0_COREF Uncharacterized protein
MGSVIKKRRKRMSKKKHRKMLRRTRVQRRKLGK
Molecular weight: 4.16 kDa Isoelectric point according different methods: