Parcubacteria group bacterium GW2011_GWA2_49_16
Taxonomy: cellular organisms; Bacteria; unclassified Bacteria; Bacteria candidate phyla; Patescibacteria group; Parcubacteria group; unclassified Parcubacteria group
Average proteome isoelectric point is 7.26
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 615 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|A0A0G1VK55|A0A0G1VK55_9BACT Uncharacterized protein
MCETEVPDDDDPSPQLQLTFPPLDTIATPFATVGSLLDDSAENEQVLLTGVGVVVVTVVVDVVVVTVVVGVGGSGTSSKQSLPPLIGVQVCGHEYWVVLVDVLVDVFVFLTHFS
MCETEVPDDDDPSPQLQLTFPPLDTIATPFATVGSLLDDSAENEQVLLTGVGVVVVTVVVDVVVVTVVVGVGGSGTSSKQSLPPLIGVQVCGHEYWVVLVDVLVDVFVFLTHFS
Molecular weight: 11.97 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0G1YLN2|A0A0G1YLN2_9BACT 30S ribosomal protein S5
MTEDTIQKNTDTKISTPGATAGEKASAPRTGAGVSRGGPRRSGGERGGGDRRGGGSRPGGRPGSGRPGKGGSRGGERARPEFDNKLIQIRRVTRVVAGGRRFAFSVAMVAGNRKGSVGVGIGKAADTATAIEKAMKNAKKNMIKVRLSNEMMIPHQVEAKSSSARVMIMPAPGRGMVAGSAVRNVLDLAG
VRNVRAKIISGSKNKLNIARAAVKALGLLRAKRLKEVV
MTEDTIQKNTDTKISTPGATAGEKASAPRTGAGVSRGGPRRSGGERGGGDRRGGGSRPGGRPGSGRPGKGGSRGGERARPEFDNKLIQIRRVTRVVAGGRRFAFSVAMVAGNRKGSVGVGIGKAADTATAIEKAMKNAKKNMIKVRLSNEMMIPHQVEAKSSSARVMIMPAPGRGMVAGSAVRNVLDLAG
VRNVRAKIISGSKNKLNIARAAVKALGLLRAKRLKEVV
Molecular weight: 23.64 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
167,913 |
20 |
1,583 |
277.1 |
30.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
8.53 |
0.67 |
4.98 |
6.48 |
4.44 |
7.75 |
1.99 |
6.95 |
6.62 |
9.4 |
2.3 |
3.79 |
2.83 |
4.11 |
5.29 |
6.28 |
6.03 |
7.41 |
1.09 |
3.08 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |