Candidatus Magasanikbacteria bacterium GW2011_GWC2_41_17
Average proteome isoelectric point is 7.48
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 770 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0XLW2|A0A0G0XLW2_9BACT Myxococcales GC_trans_RRR domain protein (Fragment)
ACFGNTGFTTCVAGAYVNDTCDSLSGATAESCNGLDDDCDEAVDEDFPLLSDDCDGGDSDECENGTYTCKLDGLGVECVNEEPEGFPGYEEVCDDEDNDCDGVIDEDDVCSSCNNPLDDLVCGQTFLGATGDVSWLDGYSCKSTLNESGNEAVFVFNSDMSGLSVMVKPINLDPATADLDVFVLSSCSAS
SCLKYGNTSATWSPTADTDYFVVVDGYKGASGEFDLQVTCKETNCSDGLDNDSDDATDCADSDCVGKVVCL
Molecular weight: 27.33 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0XIX6|A0A0G0XIX6_9BACT Uncharacterized protein
MIARARAGGAKFCGGGARLRRGFGGQARAGKNSFPPTPFLFARLRSVVSVRPAAAGRQSIVSFKKSSNFVVKIYQNPTI
Molecular weight: 8.41 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
769 |
1 |
770 |
230,499 |
27 |
2,542 |
299.7 |
33.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.72 |
1.0 |
4.97 |
6.5 |
4.86 |
6.87 |
1.7 |
7.75 |
8.21 |
9.94 |
2.19 |
4.54 |
3.49 |
3.9 |
4.31 |
5.92 |
5.07 |
6.67 |
1.26 |
3.13 |
Note: For statistics only major isoforms were used (in this case 769 proteins)
For dipeptide frequency statistics click
here