Virtual 2D-PAGE plot for 2,999 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q2N816|Q2N816_ERYLH Uncharacterized protein
MPLLVPPVEPDDEDELELLLDEELELLLEEDEPVELVMLPEVDPEVEMPPLDELELDEELDELLEDELPPDDPPVVVPGWPLVPPFELIPLVPPPELDELELEELEDDDELELLLDDELVTLPLLVDTLPELEETLPELDDTLPELEETLPELDDTLPELEDTLPLLELTLPDVLLTSTLPELDVLVTPP VVLVTPPVVLVTPPVEVDEPPVVLVTPPVEVEVEDPPLVFWLLLSMSMTIPLEPTSPPEVVVVDVIATLPPLDPPPPKKPPKKPPPKPPKPPLPPITVTPPSPPLPPTKPPPTGNTAGATETTVVPPPQ
Molecular weight: 34.94 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q2NC09|Q2NC09_ERYLH Uncharacterized protein
MKHRRQTLLMILMRFSIRIWFVLSRWLISLNRRH
Molecular weight: 4.41 kDa Isoelectric point according different methods: