Candidatus Cloacimonas sp. SDB
Average proteome isoelectric point is 6.51
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,286 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N8W9H9|A0A0N8W9H9_9BACT Uncharacterized protein
MNYVKLALVLVSAIFLITACSDNNDTTGPNNGEVILFINEFLASNDYLNTDEYGENDDWIEIYNAGSNDVNLAGMYISDDLTDITAWQIPSGNSQETTVEAGGYLVLWADKQPEQGVLHVDIKLSGDGEDIVLTDTDGTTILDSYTYVAQTTDVSMGRLPDGNDSWTYFGEGYTSMPTPGASNGSGDSPM
VMFLINEFMADNDYTLIDENGDYDDWIEIYNAGNIPGDIGGLYITDDLEELDTWQIPATNPEITTIPPGHHLILWADREMEQGILHVDIKLSADGEAIGLTEEDGITLIDSYTFGPQTTDISMGRYPDGFENWIYFGEGYDTVPTPGFENGTGAEPEAILYINEFLASNNNCLADEYGDFDDWIEIYNGG
NIPANLGGLYITDDLGNLNMWQIPDTDPDMTTIRPGGYLILWADKEPEQGVIHVDIQLDVDGENIGLVESDGSTIIDSYVFGEQTIDFSEGRLPDGSDNWEFFEDPTPGASNE
Molecular weight: 54.16 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q0V798|A0A0Q0V798_9BACT 50S ribosomal protein L34
MKRTYQPHNRKRRNKHGFRARMATKAGRKVLARRRAKGRNRLTVCD
Molecular weight: 5.55 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,276 |
10 |
2,286 |
814,155 |
38 |
4,511 |
357.7 |
40.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.84 |
0.96 |
5.87 |
7.15 |
5.04 |
6.22 |
1.67 |
9.35 |
7.19 |
9.67 |
2.13 |
6.01 |
3.24 |
3.54 |
3.79 |
6.46 |
4.99 |
5.59 |
1.05 |
4.23 |
Note: For statistics only major isoforms were used (in this case 2,276 proteins)
For dipeptide frequency statistics click
here