Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Average proteome isoelectric point is 6.7
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 14,068 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A2QEM8|A2QEM8_ASPNC Aspergillus niger contig An02c0360 genomic contig
MTEGGSAPSAPAQSGAPSVTPIVGGGAGGSTGGSTGGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSWSGSGSGGAAPSGSVVPAGPSGSVPAVPTASVPEGASAGASTTPCDTITGQTVVPVATMTEGGSAPSVPAQSGG
VVPSAPAQSGAPGAPSGAPAPSGGVVPSSPAQSGAPGAPSGGASVPAVPTASVPEGASAGASTTPCDTLTGQTVVPVATMTEGGSAPSAPAQSGAPAPSGGAPAPSGGVVPSGGASVPAVPTASVPEGASAGASTTPCDTLTGQTVVPVATMTEGGSAPSAPAESGAPGAPSGVSPSETPAAPAQSGSGN
APSGGSPAPSGGVVPSGAASVPAVPTASVPEGASAGVSTTPCDTITGQTVVPVATETVTPVPVATSATEGGSSPQITTAPVAGSGSGSGSGSETEVVTVTVTATVSVSACDW
Molecular weight: 42.1 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A2R9T7|A2R9T7_ASPNC Aspergillus niger contig An18c0010 genomic contig
MVNRRLRVRIRISGRAVLRTNIFNKV
Molecular weight: 3.14 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
14,064 |
4 |
14,068 |
6,182,633 |
10 |
7,035 |
439.6 |
48.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.36 |
1.41 |
5.51 |
5.99 |
3.66 |
6.86 |
2.51 |
4.99 |
4.39 |
9.16 |
2.21 |
3.57 |
4.01 |
6.07 |
6.26 |
8.39 |
6.02 |
6.21 |
1.52 |
2.92 |
Note: For statistics only major isoforms were used (in this case 14,064 proteins)
For dipeptide frequency statistics click
here