Proteome-pI - Proteome Isoelectric Point Database statistics

Aspergillus nomius NRRL 13137

Taxonomy: cellular organisms; Eukaryota; Opisthokonta; Fungi; Dikarya; Ascomycota; saccharomyceta; Pezizomycotina; leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus nomius

Average proteome isoelectric point is 6.39

Get precalculated fractions of proteins

Acidic

pI < 6.8

6.8-7.4

pI > 7.4

Basic

All

Virtual 2D-PAGE plot for 11,914 proteins (isoelectric point calculated using IPC_method)

Get csv file with sequences according given criteria:

* You can choose from 18 different methods for calculating isoelectric point

Protein with the lowest isoelectric point:

>tr|A0A0L1IJQ1|A0A0L1IJQ1_ASPNO Uncharacterized protein 

MSYWYSYPYSYDGYSFLGLCQDIVEFI

Molecular weight: 3.31 kDa
Isoelectric point according different methods:

Protein with the highest isoelectric point:

>tr|A0A0L1ILM2|A0A0L1ILM2_ASPNO Uncharacterized protein (Fragment) 

LLLPSLLPPLLLPSLLPPLLRLGLLLLLLRLGLLLQRRLLSLLPLLRPMFPPFSLPLVVPVFLASLLSPAPLLSRLPPLRPSPVSPLSSQLFQVLTLPLLP

Molecular weight: 11.04 kDa
Isoelectric point according different methods:

General Statistics

Number of major isoforms	Number of additional isoforms	Number of all proteins	Number of amino acids	Min. Seq. Length	Max. Seq. Length	Avg. Seq. Length	Avg. Mol. Weight
11,909	5	11,914	5,972,687	11	7,584	501.5	55.6 kDa

Amino acid frequency

Ala	Cys	Asp	Glu	Phe	Gly	His	Ile	Lys	Leu	Met	Asn	Gln	Pro	Arg	Ser	Thr	Val	Trp	Tyr
8.33	1.31	5.6	6.05	3.82	6.79	2.45	5.11	4.55	9.24	2.16	3.68	4.03	5.9	6.0	8.27	5.95	6.29	1.52	2.93

Note: For statistics only major isoforms were used (in this case 11,909 proteins)
For dipeptide frequency statistics click here

See this proteome in:

Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here

Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978

Contact: Lukasz P. Kozlowski