Parcubacteria group bacterium GW2011_GWA1_47_11
Average proteome isoelectric point is 7.28
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 696 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1TM47|A0A0G1TM47_9BACT Uncharacterized protein (Fragment)
VNGDLTEEIDIDDSEVNISQPGFYTVTYNVSDSAGNDAEEVTRTVNVSAEDGGGDEEILDGDGDSIADASDNCPAASNADQADADGDGTGDACDETPNGDEDEVVPDENGNATLNDETPEVVLTDPEQNVDITIDSGTENPTIDVSSFINEEGVGTLPGITINSDVADVFIPENTIVTGPVGWDGIIQAP
ISGTPTGGNAPAGFSVGSTVISVGSPDGTLVFDSPVTILLAGVTGTVGYRPSGSDTWQTITNVCGGTYATPNSPVAPGECAINNGTDTKIVTYHFTSFGSLNTVSSGGGGGGGGDASDTSSSKKGDSNDDGNVNVLDFNALMIQWGKTGANNTADFNDDSRVDILDFNLLMINWGK
Molecular weight: 37.3 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1RFW1|A0A0G1RFW1_9BACT Uncharacterized protein
MNSSRRYTKRKSRAPRKMAKARQTKITTPIKTVASLRLGQLIRLNSLRDSLRKVDSLLNIGELNNSEVGSLIQGGPIHPGF
Molecular weight: 9.04 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
683 |
13 |
696 |
204,095 |
20 |
2,725 |
298.8 |
33.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.76 |
0.68 |
5.03 |
6.44 |
4.39 |
7.81 |
1.75 |
6.52 |
6.61 |
9.72 |
2.04 |
3.84 |
3.08 |
4.34 |
5.23 |
6.43 |
5.83 |
7.34 |
1.04 |
3.1 |
Note: For statistics only major isoforms were used (in this case 683 proteins)
For dipeptide frequency statistics click
here