Virtual 2D-PAGE plot for 58,438 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A096T3Q3|A0A096T3Q3_MAIZE Uncharacterized protein
MATAEVQTPTVVAAEEAPVVETPPPAVVPEESAPAEAEAEAEAEAAAPADPEELPAAEQQAAAEPEAAAPAGAEEPAAADPAAEAEAAAPAGPEETPAAEQEAAAEEEAAAAPPAGAEEPAAAEPVAEAEAAAPEELAADEPEAPAPAGPQEPAAEAEEVAAPEEPEKASE
Molecular weight: 16.48 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A096TL89|A0A096TL89_MAIZE Isoform of B4F9A5 Uncharacterized protein
PRCQRRSRRPRWPRRPRRRRRPRRRRRLRRRSFPRRRSRRRTLPTLSGKLPTNFRKQLTVQLKKLAAAGKLTRVKNSFKLPATDAKPKAAKPKAPKAAPKPKPSPKAKAKTAAKPKAASPKPKAKAKAKPVAPAAASPKPRGRPPKVAKTSAKASPAKAAKKAAAPAKKGKAAAAPKKVATPKKAAAAAA PARKGVARKAKK
Molecular weight: 21.95 kDa Isoelectric point according different methods: