Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6)
Average proteome isoelectric point is 6.28
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,587 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B8HED9|B8HED9_ARTCA Putative peptidoglycan bound protein
MDNQMRPLTDEELLQEQATALPDKEVASVLDLNADLDLGINAAAPIDLAVAANANVAAPIDAAASANILSYGSDAQALSTQDAAIDQGITADANAESQQDSVIGQGDGATDAGATDPTAAGTGTADAGATGGAADAVSALPGTDSVTDPVTDAAGALNGNLLNVDVNLDADAAIAAPINGAVAANANVAA
PIDAAVAANIGSIDSQAYAISDQSATISQHIDGSADATAGQTSDLQQ
Molecular weight: 22.9 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B8HHN6|B8HHN6_ARTCA Uncharacterized protein
MGLSFRKTIKLGRNTRLNVSKSGVSASRKAGPVTINSRGRITIRLGKGLTWRL
Molecular weight: 5.81 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,561 |
26 |
4,587 |
1,463,985 |
30 |
3,532 |
321.0 |
34.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.35 |
0.6 |
5.67 |
5.49 |
3.18 |
9.24 |
2.05 |
4.22 |
2.81 |
10.09 |
1.97 |
2.56 |
3.18 |
5.6 |
6.4 |
5.9 |
5.98 |
8.17 |
1.44 |
2.11 |
Note: For statistics only major isoforms were used (in this case 4,561 proteins)
For dipeptide frequency statistics click
here