Borrelia turicatae (strain 91E135)
Average proteome isoelectric point is 7.32
Get precalculated fractions of proteins
Acidic |
![](../download.png) |
pI < 6.8 |
![](../download.png) |
6.8-7.4 |
![](../download.png) |
pI > 7.4 |
![](../download.png) |
Basic |
![](../download.png) |
All |
![](../download.png) |
Virtual 2D-PAGE plot for 818 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A1QZ56|A1QZ56_BORT9 Uncharacterized protein
MNIVLIILYYCYSLIIYKFVFYKRTKRLEFLKGFLAIRLSNDEYFSILSLDDTAVKRVVLGKIADEPNVKLDFYISEHDDFSNSVIIGSFFLDNLRKESANINVYFKIDSMMLYVYGECDGIANKSKFDLSLINLAVDSEEINDLESAKSSDLPVGFSGVEREEEFVKEFGSVAGQYDSLDGDLDNFNDL
PNSQNLSADEKLFSNENNFNLLSDSLNSDNGTLVSENLDSDSDLNLENFDFGLTGDGFENNIDEGNDLEEHVLNDKDTVSRDDFDLDNISVDISDSSAASDNSAANAVKLVEDKDTDFKSVNVYTLQDSYSDNWDVEDIITDLDNGLGESEFDDVALDFSKEDFATDIEESRLDLDSEEGLIQTSMLYLS
LISLFLLIFFSLFLIFSKVLNPRNFAIYDCPFYKEEKITKCENSNYV
Molecular weight: 48.35 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A1QZM6|RL34_BORT9 50S ribosomal protein L34
MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRSKLTVSDEKKKY
Molecular weight: 6.14 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
816 |
2 |
818 |
286,483 |
37 |
2,301 |
351.1 |
40.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.51 |
0.72 |
5.5 |
6.72 |
5.96 |
5.35 |
1.42 |
10.79 |
9.48 |
10.36 |
2.04 |
6.92 |
2.39 |
2.48 |
3.59 |
7.15 |
4.22 |
5.59 |
0.52 |
4.29 |
Note: For statistics only major isoforms were used (in this case 816 proteins)
For dipeptide frequency statistics click
here