Daphnia pulex (Water flea)
Average proteome isoelectric point is 6.79
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 30,137 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E9G1L6|E9G1L6_DAPPU Putative uncharacterized protein (Fragment)
ETPESFFVANDENHHDDSVVDEDTDDAVVVESADDVADTSGDSQELEPVAELNESQEESGAEAEAVGEEQEPVPQAELEPEPEQEPEQEPEPEPEPEPELNVDGFGEAESLENLEEETEQPEEENETAAADEEPVNEEEAAEEEEEPTAEEEPAEEEAPNEEEPAAAEEEPTNEEGAMEEEPTNEEEAAE
EEPTNEEAVEEAGEDEPAQEEEVTEEPAAVEEETVITEEEAVPTEDETQPAEEEEVAVVEEEASAVEEEESALAEEETLLLVEEETMEPAEEEVTLAEEEATGIEEEDSQPAEEVTEDQAPAANEEEVVPSAEPESVEAAAEEEAPEAE
Molecular weight: 36.93 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E9I7B7|E9I7B7_DAPPU Putative uncharacterized protein (Fragment)
VQGPRSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFTKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFAKVRQGSPRFA
KVRQGSPRFAKVRQGSPRFAKVAKVRQ
Molecular weight: 24.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
30,109 |
28 |
30,137 |
9,930,448 |
20 |
7,776 |
329.8 |
36.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.94 |
1.93 |
5.3 |
6.41 |
3.96 |
5.69 |
2.44 |
5.28 |
5.72 |
9.16 |
2.26 |
4.66 |
4.44 |
5.43 |
5.51 |
8.38 |
5.94 |
6.41 |
1.2 |
2.95 |
Note: For statistics only major isoforms were used (in this case 30,109 proteins)
For dipeptide frequency statistics click
here