Candidatus Roizmanbacteria bacterium GW2011_GWC2_34_23
Average proteome isoelectric point is 8.07
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 783 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0DIB9|A0A0G0DIB9_9BACT Uncharacterized protein
MVGIGDTTPLATLTVGDGDLFQVAGATGNVLTSGTMTAATDETINGIDISSGTVSDVVNLTINTGGDLTIGAIGLNDVGTTNITSGASLVGVFDEFDNSASTTVQDVLDDLDAAITTGGGSSMWSLTSGVIYPTTVTNDLAIGGTTLAASMFGIDESAGNFYFGYDNSANPTLNFEATDADAGEFGFNTN
DAFYFSNANVGIGTTGPGAKLEVDIDSSTAYSATAYAIGVNANDALNLYNANASAALTSIRFLDRPSGASVGRIGLLNNGTADGSGDFVFMLRSAADTSNTDEMMRITSTGNVGIGTTGPGYKLDVSGNARITSEASIGSYIVVGGNQVMNGSEVYWSNEGRGGYNFGSLAGGGAKQFNISSGSVSYTGG
LITLSTDGSERMRINSSGNVGIGTTGPEYLLHLQAAVNPVIATKDTTNNVVXSRNRV
Molecular weight: 44.16 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0AWB4|A0A0G0AWB4_9BACT 50S ribosomal protein L35
MAKNKPKTRKSAVKRFRVSPKGKVLNRGQAFRHLRGKKNKSWLRRKKRLLEVSGRMKRKVLMMLGKK
Molecular weight: 7.96 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
782 |
1 |
783 |
216,158 |
28 |
1,264 |
276.4 |
31.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.36 |
0.69 |
4.77 |
6.11 |
5.8 |
6.08 |
1.42 |
9.52 |
9.9 |
10.02 |
2.0 |
5.42 |
3.12 |
3.65 |
3.55 |
6.34 |
5.29 |
6.16 |
0.91 |
3.89 |
Note: For statistics only major isoforms were used (in this case 782 proteins)
For dipeptide frequency statistics click
here