Desulfosporosinus youngiae DSM 17734
Average proteome isoelectric point is 6.47
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 5,108 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|H5XWI7|H5XWI7_9FIRM Collagen triple helix repeat protein
MGATGATGATGDVGATGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDTGATGATGATGDVGATGTTGATGDAGATGGTGATGDAGATGGTGATGDVGVTGGTGATGDAGATGATGATGDTGATGATGATGDVGATGTTGATGDAGATGGAGATGDAGATGGTGAT
GDVGATGATGATGDAGATGTTGATGDAGATGATGVTGDSGATGATGAMGDTGSTGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDAGATGATGATGDVGATGTTGATGDAGATGTTGATGDVGATGATGATGDAGATGATGATGDAGATGVTG
ATGYVGATGATGATGDAGATGATGATGDVGATGSTGTAVGASSAFAANTTGTSYVVTVITPATITFPSAQNLGTGITINGSNTIFTLANAGRYYISYAANTTLALLVGTRLVVNGSNVAAATILPLISTASYYADIIITATANTTISVEFFGVAATAILLTGSAGATINIIRLS
Molecular weight: 46.76 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|H5Y698|H5Y698_9FIRM 50S ribosomal protein L34
MKRTYQPKNRRHKRVHGFLSRMSTPTGRNVIKRRRLKGRKKLSV
Molecular weight: 5.36 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,071 |
37 |
5,108 |
1,551,908 |
29 |
4,202 |
306.0 |
34.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.88 |
1.11 |
4.98 |
6.87 |
4.05 |
7.45 |
1.78 |
7.4 |
6.14 |
10.44 |
2.65 |
4.11 |
3.75 |
3.93 |
4.74 |
6.08 |
5.29 |
7.0 |
1.06 |
3.29 |
Note: For statistics only major isoforms were used (in this case 5,071 proteins)
For dipeptide frequency statistics click
here