Megasphaera cerevisiae DSM 20462
Average proteome isoelectric point is 6.51
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,843 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0J6ZJS8|A0A0J6ZJS8_9FIRM Uncharacterized protein (Fragment)
EFESDTLVLVDALSDVLTEFESDTLVLVDALSDVLTEFESDTLVLVDALSDVLIEFESDTLVLVDALSDVLTEFESDTLVLVDALSDVLTEFDPETLVLVDALSDVLIEFESDTLVLNDALSDVLTEFDPETLVLVDALSDVLIEFESDALTDVESDALADVESDALVDAESLALVDAESLALTDAESDA
LTDAESDALTDAESDALTDAESDALTDAESDALADAESLALTDAESDTLTDAESDALTDAESLALVDAESDALTDAESDALVDAESDALTDVESDALTDAESDA
Molecular weight: 30.84 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0J6WZT9|A0A0J6WZT9_9FIRM 50S ribosomal protein L34
MKQTYQPNTLWKKRTHGFRERMKTKGGRMVLKKRRMKGRKKLSA
Molecular weight: 5.38 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,822 |
21 |
2,843 |
857,137 |
31 |
2,682 |
303.7 |
33.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.81 |
1.46 |
5.5 |
5.92 |
3.95 |
7.5 |
2.29 |
7.47 |
5.76 |
8.93 |
3.11 |
3.87 |
3.77 |
3.79 |
4.77 |
5.57 |
5.7 |
7.08 |
1.01 |
3.72 |
Note: For statistics only major isoforms were used (in this case 2,822 proteins)
For dipeptide frequency statistics click
here