Virtual 2D-PAGE plot for 5,016 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0F2SH44|A0A0F2SH44_9FIRM Uncharacterized protein (Fragment)
VEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEAVEAEVTPEVVEAEVTPEVVEAEVTPEVVEAEVTPKVVEAEVTPEVEAEVTPEAAEAEATPETPEAQ
Molecular weight: 16.2 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0F2S5L1|A0A0F2S5L1_9FIRM Uncharacterized protein
MKSLMGQRGYSPIQQNRFSPIQRQGTNSVPRQGPGPSSVKQQIFTPTSQATHPIVQPMIQSVTPPVTQPVTQPVTQPVTQSVAQPASVQKQLNSLPQTSSATPEPSNLWQQQVGILITKYGPSLMRQFGPPLARKVGLPIAQHIGPPLAQKVGIPLARRVGLPLLRKVFLPLAKRAGFALIRRIGLPL
Molecular weight: 20.36 kDa Isoelectric point according different methods: