Pseudomonas resinovorans NBRC 106553
Average proteome isoelectric point is 6.4
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,795 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|S6BNT1|S6BNT1_PSERE Uncharacterized protein
MFKYKPLAAAILALVSIQALADDSLSTQTQSGLENVAEVLQSAATDSTATQDQVGEGNNAFADQSAGTGTVLQTQDGDYNASTGVQSGVTESSVDHNQTGEWNGAHSEQWFSENSAANVTQTGSDQQAFSYQDSQISSTIDINQGDQANVANAEQVFGEGNTTTINQSGTDNETSTWQVDQIGSTIGIQQ
SGTGNIANVDQTLGQGNQVDVFQTGESGYIEVWQTEQENSQAVVDQDGTLNELVVDQSYGSGNLATMTQDGNANAAWADQYESNDSVATVTQTGDSNLSLTYQEGDRLDLTVNQNGNDNNVFASNWQGAQEGGQFGSDQVVLLNQTGDGNTANFTQEGNFNELYFDQTGDDNSLTVSQRDGGNLAEGTSE
GIGNIVEVDQSGSENISQTFQSAGGDNLASITQADVNNFSIVSQVGWGNQASVNQSGLNGVSTIDQNGTGNSATVVQQ
Molecular weight: 47.96 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|S6BQU6|S6BQU6_PSERE 50S ribosomal protein L34
MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLTV
Molecular weight: 5.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,515 |
280 |
5,795 |
1,791,492 |
43 |
5,569 |
324.8 |
35.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.42 |
0.98 |
5.45 |
5.97 |
3.63 |
8.38 |
2.2 |
4.43 |
3.13 |
12.03 |
2.22 |
2.88 |
4.34 |
4.97 |
6.88 |
5.52 |
4.57 |
7.07 |
1.45 |
2.49 |
Note: For statistics only major isoforms were used (in this case 5,515 proteins)
For dipeptide frequency statistics click
here