Xenococcus sp. PCC 7305
Average proteome isoelectric point is 6.2
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,347 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|L8LZ03|L8LZ03_9CYAN Uncharacterized protein (Fragment)
EEDFNGIDTYSYTIADGNGGTATANVEITVESINDDPIAVDDEDTTDEDTAVTTAVLDNDSDPDEDSLTVTSATDGGNGTTTVNADGTITYTPEEDFNGTDTYSYTIDDGNGGTATANVEITVGSVNDDPIANDDADTTDENTPATTAVLDNDSDPDEDSLTVTSATDGANGTTVVNADNSITYTPEEDF
SGTDTYSYTIADGNGGTATANVEITVESINDDPIANDDADTTDENTPATTAVLDNDSDPDEDSLTVTSATDGANGTTAVNADGSITYTPEEDFSGIDTYSYTIDDGNGGTDTAIVTITVENLPPDAVDNSYETSGATPVSGNLITDDTGEISPITGLGVDSDPEDDTLNVLEFTDPGAGTVVVEDDGSFT
YTPNEGFAGVDSFTYTIDDGNGGT
Molecular weight: 41.43 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|L8LYQ2|L8LYQ2_9CYAN 50S ribosomal protein L34
MTKRTLGGTSRKQKRKSGFRARMRTKNGRKVIQARRKKGRHRLSV
Molecular weight: 5.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,293 |
54 |
5,347 |
1,678,220 |
20 |
10,636 |
317.1 |
35.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.61 |
0.93 |
5.48 |
6.54 |
4.16 |
6.64 |
1.68 |
7.55 |
5.29 |
10.78 |
1.71 |
5.04 |
5.06 |
4.2 |
4.51 |
6.72 |
5.53 |
6.07 |
1.34 |
3.16 |
Note: For statistics only major isoforms were used (in this case 5,293 proteins)
For dipeptide frequency statistics click
here