Sulfurimonas autotrophica (strain ATCC BAA-671 / DSM 16294 / JCM 11897 / OK10)
Average proteome isoelectric point is 6.64
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,155 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E0UUU1|E0UUU1_SULAO Uncharacterized protein
MKILLLNDNPVVNKLVTLSAQKTSDEVDITSTIEGIESQNYDLLIVDDSVYSDELLSELQEQEKVKYKKSLFICAKDAEEVESFSSIILKKPFLPTDLVELFMMFEKEVASEVDKEMPVEETQVEEIQSSDLEELSDELSLDDEESLGESVLDDEEAQKVKDLLDENEEELSFDEEVENDIESLELDEEE
GLAEVPEEAEEDLELEDDDLLADYDMALDLEDEADVDIAEEDSFDLEDEVETLEDEELEELDTATVAELEDEIDDVVTEELSEKEGDLAVDMALDLEDEADIDISHDMVDEFNLEEDIEEPEEESVQEPEEEVEEEPEDVDTPAVAELEDIIENEEAEEEPEEVVEAEDINLESEIQSAVENLSQEDLES
ELDEDTLLQIATNEIDPLADLTSKDLKVALGEELEEVEEVDTAAVAEIEDTIMSEEEDEGQNSGVEALKKLLEALSDKDVAASMKGMKISINITLGDN
Molecular weight: 53.69 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E0UPI6|E0UPI6_SULAO 50S ribosomal protein L34
MKRTYQPHNTPRKRTHGFRARMATKNGRNIINRRRAKGRKKLTV
Molecular weight: 5.3 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,152 |
3 |
2,155 |
672,029 |
30 |
1,662 |
312.3 |
35.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.08 |
0.86 |
5.69 |
6.93 |
4.87 |
5.73 |
2.04 |
8.36 |
8.71 |
9.75 |
2.69 |
5.31 |
3.19 |
2.97 |
3.27 |
6.26 |
5.12 |
6.36 |
0.73 |
4.08 |
Note: For statistics only major isoforms were used (in this case 2,152 proteins)
For dipeptide frequency statistics click
here