Virtual 2D-PAGE plot for 5,113 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|D2RP56|D2RP56_HALTV Uncharacterized protein
MAPDDDSTPATGTLLVTLAVVLLTFAVGVVAVSDVGPDPIGPDNDDPAEQSADDPDGVDAETAANDSSAASSIAESDEANASNESDGVDPGGESETGVDDSSDDEPASDSGDESAEPETDPGDESDEPETDPAVDDEPPSEDDDVPTGPFDDGEPSDPFDGDGPDVPDDGPFDDEEPDSDDGLFDDAEFS DDPFDDDDGSDESGPPDDAGPPDDAGPPDDAGSPGNGPP
Molecular weight: 22.91 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D2RR94|D2RR94_HALTV Uncharacterized protein
MALRKLLGSKATRSLTVVSVLSDAKRAFNRGNRTRGLLLVGVAVLAWKWTVLGMAAQGIVKLLRRGGSAASSPA
Molecular weight: 7.78 kDa Isoelectric point according different methods: