Tursiops truncatus papillomavirus 1
Taxonomy: Viruses; dsDNA viruses, no RNA stage; Papillomaviridae; Upsilonpapillomavirus; Upsilonpapillomavirus 1
Average proteome isoelectric point is 6.29
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 7 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|B4XYE0|B4XYE0_9PAPI Protein E6
MANTNPCTIIELCEQFDLDLYELFICCVFCRKVLEDIEKWSCRNREINVVWKKEYPYAVCCKCLEVQAILDLLRYFERSGSAKTVEEDTGKPLGDLRVRCYGCYKPLTATEKLFHVEDQRPFTKVCNQWRGICTNCQYLPPRLLYYFFTIAGRTVRSPLPGLTWGFDPPPANLSESESSSWTTTTTSSDT
SSQTSSSVTSGRRDDNLSDAESNENDDENPEVLI
MANTNPCTIIELCEQFDLDLYELFICCVFCRKVLEDIEKWSCRNREINVVWKKEYPYAVCCKCLEVQAILDLLRYFERSGSAKTVEEDTGKPLGDLRVRCYGCYKPLTATEKLFHVEDQRPFTKVCNQWRGICTNCQYLPPRLLYYFFTIAGRTVRSPLPGLTWGFDPPPANLSESESSSWTTTTTSSDT
SSQTSSSVTSGRRDDNLSDAESNENDDENPEVLI
Molecular weight: 25.61 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|B4XYE3|B4XYE3_9PAPI E4
MNLHLYLVPPTRKPWDTPYYQRLQDGWKLSGHNSKNPKAENTWDPHHHHHHHHHQPHQHQYRSLNLQNQTQNQSQQRPASPTPLSPPVQPAAPSPSAAPIVEQEIVVPVGESVTVTVTVGVQNGPEVTLTFQLS
MNLHLYLVPPTRKPWDTPYYQRLQDGWKLSGHNSKNPKAENTWDPHHHHHHHHHQPHQHQYRSLNLQNQTQNQSQQRPASPTPLSPPVQPAAPSPSAAPIVEQEIVVPVGESVTVTVTVGVQNGPEVTLTFQLS
Molecular weight: 15.14 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
0 |
2,481 |
31 |
639 |
354.4 |
39.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
5.8 |
2.66 |
5.8 |
5.84 |
3.71 |
6.65 |
2.5 |
4.64 |
5.04 |
8.79 |
1.89 |
3.99 |
3.87 |
7.13 |
5.36 |
8.3 |
6.93 |
6.49 |
1.69 |
2.9 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |