Virtual 2D-PAGE plot for 5,534 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0T5P5R6|A0A0T5P5R6_9RHOB Uncharacterized protein
MRNLLWIIIAVLVIGGGYLLFTGKSVQEVLGTADEAATEAAEEASEAADAAGESAEEAAEAAEAASEEATDTTEGMAEEAAEALDEATEAAEDAAADATEAAEDAVDTAEEAVEDAAAAVDDAADNAVDDASEAAEAAEDAAGDAMEATEEAAGDAVEATEDAANNAMEAAEGTADAAAEEAGDAMEAAE DTAGDAAEATEEAADDAAEATEETASDAAEATEEAAESAAETADDAAQATEDEIIEITNDTAEEAEQAAEEAMEATEDEAADTAEATEEAMEESMDTTEGADTGASADAAAEVGVEGADAEELFTVDGFNLDRAVEMIEASDLDAIRRTVLIETLREAAGNPEQLETALTAAREALGL
Molecular weight: 36.86 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0T5PBB8|A0A0T5PBB8_9RHOB 50S ribosomal protein L34
MKRTFQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA
Molecular weight: 5.14 kDa Isoelectric point according different methods: