Parcubacteria group bacterium GW2011_GWA1_56_13
Average proteome isoelectric point is 7.23
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 759 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1YKU0|A0A0G1YKU0_9BACT SD repeat-containing cell surface protein
MSEVGIEGLTDADSELEGENEAEGDKLGESDAEGELDALGDGDGEMDELGEREADGDWLGDSEAEGETDGLGEADGDWLGDSEAEGESEAEGDSDGETDDEGESEAEGEREGEAELEGEMDALGDIEGLSDAEGESEADGLSDGETDELGESDALGESDGLSDAEGESEGETDGLGEAEGDWLGDSELEG
ESEAEGERLGDSELEGDNEAEGESEGEAEAEGEIEAEGEIEEDSEAEGERDADGESEGLSDVDGESEAEGEIEGDSDAEGDWLGDSEAEGESDADGESDGEMDELGESEAEGENDGDSDAEGESEAEGESDGETEELGESEALGERDGDSEVEGESEAEGENDGDSDADGESEADGLSDGDSEVEGESEA
DGD
Molecular weight: 39.06 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G2APF5|A0A0G2APF5_9BACT Uncharacterized protein
MKTNKSYMKRIRVTRTGKLVTRRPGQNHFNAKQSGSERSQKRRSTLLHLSARVRRRFLPGS
Molecular weight: 7.17 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
759 |
0 |
759 |
208,288 |
32 |
2,418 |
274.4 |
30.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.8 |
0.63 |
4.88 |
6.17 |
4.27 |
7.85 |
2.0 |
6.05 |
5.15 |
9.57 |
2.2 |
3.08 |
2.78 |
4.68 |
6.07 |
6.37 |
5.97 |
7.42 |
1.05 |
2.99 |
Note: For statistics only major isoforms were used (in this case 759 proteins)
For dipeptide frequency statistics click
here