Wenxinia marina DSM 24838
Average proteome isoelectric point is 6.34
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,030 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0D0QA61|A0A0D0QA61_9RHOB Uncharacterized protein
MAEQKSTNMALIIGAVAVGVGVILAVAIGLSEDAPSPGADTTAMDQPIAEQEVTPQPGPASEEATADETDTEELIEAPGAGDALADEDAVEEAVEDGEDVVVEEAATDTPDSADAADDEPAVDMTAAGAGEDEGGEEATEDAAAAAADEVEADAAADEAAVEEAAADEGPAADEAAADEATADEADGEEA
AADEAATDDAPAVTEEAQAAEPAAEDQAAPAATDGAVTFAVPVEPIGGTATAEEPAAEPTADAAEAPEEDTVLAEEPAAIEPSAEEPIAPPADTATAEEGAETAAAEEATAEEASADTADEEQPADEALAEELGDVPDEGGMDGGQDTEFAGESGIATGAEGQYIGPDATGTGEGETDQAQAEEAPADEG
GATEEAAAETDGDASGTDETAASDEAPAEEQTTAEDATTLYRIEELEDGTQIIRLRTGEAALGDGAAAPAAEGGNSAQLLDIARQSAEAAEAAADAASEAAAAARAALEALEGADGEPAEASQ
Molecular weight: 49.06 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0D0Q3Y6|A0A0D0Q3Y6_9RHOB 50S ribosomal protein L34
MSKRTFQPSNRVRKARHGFRARMATKGGRKVLNARRARGRKRLSA
Molecular weight: 5.22 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,009 |
21 |
4,030 |
1,229,946 |
24 |
7,873 |
306.8 |
33.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.68 |
0.81 |
6.18 |
6.1 |
3.42 |
9.39 |
1.92 |
4.51 |
2.06 |
10.18 |
2.49 |
2.05 |
2.65 |
5.61 |
7.78 |
4.58 |
5.41 |
7.59 |
1.54 |
2.06 |
Note: For statistics only major isoforms were used (in this case 4,009 proteins)
For dipeptide frequency statistics click
here