Candidatus Jorgensenbacteria bacterium GW2011_GWC1_48_8
Average proteome isoelectric point is 7.4
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 630 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1XV87|A0A0G1XV87_9BACT Uncharacterized protein
MGFDGDDESIVLDELGDVMFLSSFEYVYELLCEGVD
Molecular weight: 4.05 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1X673|A0A0G1X673_9BACT Sperm nuclear basic protein PL-I isoform PLIb (Fragment)
MPLWFINPSRKRKMKKNPYGKCPKCHVVLTPSGRVCAFCRGKALKKNPFTTSARKLQARRQARWLATGGKLDSLWESEKERSRKDRKKQVYKKRHNKTGKFSKNPYKKGKSMKRRRPSLKRLIARAKARLYGAARKQRIKGLRKKYRKNPWVGRGKNRRWQKRGGLDLAIRLAARAQREAVRKHGYSPSA
KRAVTRFKKKAAKAYKKRLAAWRRQSKAMSPKRRPSRKSPKRKAVKRARRKAVSRVSKSRKRSLAGKKAARTRARKKAARRAAGRKAARKRKRKSGGRKMARKFRRLKHGRRTKKRHGRGVRALARSRRSIKYSRRHGSGAARRYLKRYRMRSNPIAMLKDIASNVLPLAAAFFGARFVSSKVPGLPVVG
PLLGNLGSGAPVAVAGAVAIGAHFLTKKVSALAKYRSAIMSGAGLNVLFTAIDAFAPASIKGFLGMGDSGVYDEALGNYTSDVAGYE
Molecular weight: 52.68 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
625 |
5 |
630 |
154,169 |
23 |
1,366 |
246.7 |
27.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.98 |
0.64 |
4.71 |
7.18 |
4.78 |
7.52 |
1.57 |
6.89 |
7.52 |
10.03 |
1.88 |
4.13 |
2.74 |
4.3 |
5.55 |
6.0 |
5.05 |
7.29 |
1.17 |
3.05 |
Note: For statistics only major isoforms were used (in this case 625 proteins)
For dipeptide frequency statistics click
here