Flavihumibacter sp. ZG627
Average proteome isoelectric point is 6.82
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,302 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0C1IEY9|A0A0C1IEY9_9SPHI Uncharacterized protein (Fragment)
TESGTFNYTVTTVGPCAEATANGTITVQPNSTINLTSAAATEEQILCINTPITNISYAVGGTGNDATVTGLPAGVSGNYSGGVFTISGTPTESGTFNYIVTTVGPCAEETVSGTITVQPNSSISLTSAAVTESQTLCINTPITNITYAVGGTATDATVIGLPDGVTGTYIAGVFTISGTPTESGTFIYIV
TTVGPCAEETVSGTITVQPNSSISLTSAAATEAQTLCINTPITNITYAVGGTATDATVTGLPTGVLGNYSAGVFTISGTPSVTGTFNYVVTTVGPCAEAMANGTITVQPNSTISLTSAAVTEA
Molecular weight: 31.0 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0C1ID22|A0A0C1ID22_9SPHI 50S ribosomal protein L35
MPKVKTNSSAKKRFKVTASGKITHQKAFKRHILTKKSTKRKRGMRKAGVVSKPNMDFVQRLLGLKG
Molecular weight: 7.47 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,287 |
15 |
3,302 |
1,134,486 |
35 |
2,898 |
345.1 |
38.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.63 |
0.82 |
5.26 |
5.98 |
4.79 |
7.17 |
1.96 |
7.25 |
6.34 |
9.55 |
2.62 |
5.19 |
3.67 |
4.02 |
4.56 |
6.42 |
5.41 |
6.27 |
1.3 |
3.79 |
Note: For statistics only major isoforms were used (in this case 3,287 proteins)
For dipeptide frequency statistics click
here