Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Average proteome isoelectric point is 6.7
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 10,657 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B2AN75|B2AN75_PODAN Podospora anserina S mat+ genomic DNA chromosome 6 supercontig 4
MRVSTLSLGALAVGLGAATEWPDCHEDNCYRNLIDANYAAEASAFCPGFIAGTTTAAIAIPTNFYNCDGSVQSVSSVCSCIVYTMTHTSATATAEPTTEPSVEPTTTTIETYTISETWTSEEPTSTSTDEDDYCEDDETTTTEPTATPTDEPTVTPTDEPTVTPTESEEPTATPTDSEEPTVTPTDEPTV
TPTDEPTVTSTETEAPTTTDDDYCEDDETTTTEPTVTPTDEPTVTPTDTEEPTATPTDEPTEEPTEEPTATPTDTEEPTVTPTDTEEPTATPTGGPTTTDDDYCEDDETTTEPSATPTDEPTVTPTDEPTVTPTDEPTEEPTVTPTETEEPTATPTAEPTEEPTEEPTATRTDGPTEEPTEEPTATPTDE
PTEEPSVTDTPTITTTKDEDSTGTTTTEEWTTSTITTTTVKTITQCPSTVPACPTGGVVIVTTETIVTTTVCPVTDVPALPTTTEGGEVTPPIVTDGPEVTGGPGPEVPPTSTDEEEPPVVTDGPEVTGGPGPEVPPTTTEEPEEEPPVVTDGPEVTGGPGPEVPPTTTEEEEPIVTGGPGGEEPPVVTD
GPDVTGGPDVEPPVVVVPTSFGTVTVPAVTDLPSTTNTPVTAGAGRAVGPVEGLLAAVAGLAAVLL
Molecular weight: 65.61 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B2AX81|B2AX81_PODAN Podospora anserina S mat+ genomic DNA chromosome 7 supercontig 1
MRAKWRKKRVRRLKRKRRKMRARSK
Molecular weight: 3.37 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,656 |
1 |
10,657 |
5,371,468 |
14 |
8,070 |
504.1 |
55.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.44 |
1.21 |
5.48 |
6.38 |
3.61 |
7.35 |
2.38 |
4.55 |
4.95 |
8.76 |
2.14 |
3.6 |
4.02 |
6.53 |
6.18 |
7.96 |
6.09 |
6.28 |
1.48 |
2.63 |
Note: For statistics only major isoforms were used (in this case 10,656 proteins)
For dipeptide frequency statistics click
here