Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Average proteome isoelectric point is 6.69
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3,594 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0L7N9|A0L7N9_MAGMM Uncharacterized protein
MEEILASLEEILDEAEDDQHGLEALRAKPYPSMAVGGEPTPRFEWADEDDTSEQNRLYMADPFAPDQAEEAGDGAVASEDEIVDLSGMETVAVVEEAVEEAAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEQAVEEEAEEVAEEEAEEEAEEEAEEVAEEEAEEVAEKEAEEVAEEEAEEVAEEEA
EEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEGEEVAEEEAEEEAEEEAEEEAEEEAEEVAEEVAEEEAEQAAEEEAEQAAEEEAEEVAEEEAEQAAEEEAEEIAEEEAEEIAEEEAEEIAEEEAEEVAEEEAEE
AAEEEAEEAAEEEAEEAAEEEAEQAAEEEAEQAAEEEAEEVAEEEAEQVAEEEAEQVAEEEAEEVAEEEAEEAAEEEAEQAAEEEAEEVAEEDAEEVAEEEAEEVAEEDAEEVAEEEAEEVAEEEAEEVAEEEAEEVVEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEAEEVAEEEA
EEVAEEEAEEAAEEEAEEAAEEEAEEAAEEEAEEAAEEEAEQAAEEEAEQAAEEEAEQAAEEEAEQADEKGTVPDSVNAEAILALAREIAEQMIREQLPELLEKIIREEVERVRRGQ
Molecular weight: 75.7 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A0LE52|RL34_MAGMM 50S ribosomal protein L34
MKRTFQPSKIRRKRTHGFRARMATKNGRKVLAARRRKGRKALIP
Molecular weight: 5.23 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,580 |
14 |
3,594 |
1,320,780 |
37 |
15,245 |
368.9 |
40.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.95 |
0.95 |
5.28 |
6.13 |
3.46 |
7.82 |
2.63 |
4.99 |
3.9 |
10.98 |
2.83 |
3.17 |
5.15 |
4.79 |
5.99 |
5.78 |
5.3 |
7.05 |
1.38 |
2.48 |
Note: For statistics only major isoforms were used (in this case 3,580 proteins)
For dipeptide frequency statistics click
here