Caldilinea aerophila (strain DSM 14535 / JCM 11387 / NBRC 104270 / STL-6-O1)
Average proteome isoelectric point is 6.44
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 4,097 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|I0I6I7|I0I6I7_CALAS Uncharacterized protein
MGEGEEGTSDLIVYYGPLGAGVVASIQFLDADQQVIYSASLLLSANVGGAQVQVTYPDAPTPYRFVRFTSVLSAYTIDAVEAATYRPDSDNDGLPDVWEIQYALDPLDPTGDNGAAGDPDNDGLTNQQEWTAGTNPTNPDSDGDGLPDGWEVQYALNPLDPTGDNGAAGDPDNDGLTNQQEWTAGTNPTN
PDTDGDGLPDGWEVQYALNPLDPTGDNGAAGDPDNDGLTNQQEWTAGTNPNNPDSDGDGLPDGWEVNNNTNPTNPDSDGDGLPDGWEVQYALNPLDPTGDNGAAGDPDNDGLTNQQEWTAGTNPNNPDSDGDGLPDGWEVNNNTNPTNPDSDGDGLPDGWEVQYALNPLDPTGDNGAAGDPDNDGLTNQQ
EWTAGTNPTNPDSDGDSLPDGWEVQHALNPLDSTGNNGAAGDPDNDGLTNQQEWTAGTNPTNPDSDGDSLPDGWEVNNNTNPTSSDSDNDSLTDGWEVQYALNPLDPTGDNGAAGDPDNDGLTNQQEWTAGTHPNNPDTDGDSLTDGWEVQYALNPLDPTGNNGAAGDPDNDGRTNLEEYLAGTNPVEFD
GALFLPLILRE
Molecular weight: 60.82 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|I0HZM6|I0HZM6_CALAS 50S ribosomal protein L34
MATKRTWQPKVRKRLKTHGFRIRMSTPGGRKVLKRRRLKGRARLTVQLSHRKAI
Molecular weight: 6.45 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,943 |
154 |
4,097 |
1,433,637 |
37 |
5,788 |
363.6 |
40.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.19 |
0.83 |
4.88 |
6.2 |
3.77 |
7.7 |
2.13 |
5.33 |
2.38 |
11.0 |
2.23 |
2.89 |
3.87 |
5.78 |
7.04 |
4.95 |
5.5 |
7.64 |
1.78 |
2.9 |
Note: For statistics only major isoforms were used (in this case 3,943 proteins)
For dipeptide frequency statistics click
here