Cryomorphaceae bacterium BACL21 MAG-121220-bin10
Average proteome isoelectric point is 6.43
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 1,662 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0R2RZ09|A0A0R2RZ09_9FLAO Uncharacterized protein
MLVMATLIMTSCDNEPLEGNFITEEEAQDNSAFTATVNGEPFSASSTTGQLINGVLLLTGTDYFGNIISMVITNIGVCTFDLTQELNPSSFILEAPTESPFEVLSSIGGSGTTVIAAYDSENQTVTGTFNFTAIRQISDGAGGTITESVVISNGILQEIPFTLIDGSLDPYACDVTDPGGGSGGSNNQDP
DNTFFALVDGEEFVDISFVSEVLMVGSDEVVKLTATTQTLERVQFFIPINIGAGTFTFSPIFNGSNLFASYTDSDGTESLTSLEGSITFQEYGIITGKMTASFAFTGTDPIGINIEEVMVSEGTFTMDYLPESGIAENTLTAVVDGVSYTPSSMQVLLNPQMDTTYVEIITVNDETNQAISLSFPIDIMP
GTYDMSAVVELGTEAVGTYNPAIGDAILYRSQPGTLTITSYQFDNGVIEGQFSFTAFDPNGVGGDVYEITEGFFTLTLP
Molecular weight: 48.66 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0R2RXQ1|A0A0R2RXQ1_9FLAO 50S ribosomal protein L20
MPRSVNSVAKRARRKKIIKQAKGYFGRRKNVWTVAKNAVEKAMQYAYRDRRAKKRTFRALWITRINAGARLHGLSYSQLIGKLKAHDIELNRKVLADLAMNHSEAFTAIVNKVK
Molecular weight: 13.16 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,659 |
3 |
1,662 |
562,935 |
50 |
2,388 |
339.3 |
37.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.87 |
0.75 |
5.71 |
5.63 |
4.87 |
7.13 |
2.25 |
6.93 |
5.72 |
9.96 |
2.5 |
4.64 |
4.61 |
3.92 |
4.12 |
6.19 |
5.7 |
6.51 |
1.18 |
3.81 |
Note: For statistics only major isoforms were used (in this case 1,659 proteins)
For dipeptide frequency statistics click
here