Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)
Taxonomy: cellular organisms; Eukaryota; Opisthokonta; Fungi; Dikarya; Ascomycota; saccharomyceta; Pezizomycotina; leotiomyceta; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Trichocomaceae; Talaromyces; Talaromyces stipitatus
Average proteome isoelectric point is 6.59
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 13,022 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|B8MJ20|B8MJ20_TALSN Uncharacterized protein
MEVYINQIQSSSGAYEESCTQCELLDGAATLQCYCTGTFANESGNSTLNLEEYIANYDGHLLSSLEGTPSVPSDSSLAVPSNVVLSLNAFVGTGTSCPSNEGAYLNFVGPEPCWGLYVSPEPVVWSSFRATSNPGWSISVYNVSTCTGTPIVTFDQDSVNDCIAVGQDGGIYLSIMPLWNWD
MEVYINQIQSSSGAYEESCTQCELLDGAATLQCYCTGTFANESGNSTLNLEEYIANYDGHLLSSLEGTPSVPSDSSLAVPSNVVLSLNAFVGTGTSCPSNEGAYLNFVGPEPCWGLYVSPEPVVWSSFRATSNPGWSISVYNVSTCTGTPIVTFDQDSVNDCIAVGQDGGIYLSIMPLWNWD
Molecular weight: 19.4 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|B8MRT9|B8MRT9_TALSN Uncharacterized protein
MSTSTNMRVFRLRSAWRLSQTSRLSAPRYQNQFRSVATKQASPAYPQTSSTLNQAIPNPSPSTSLAVKKLVTPIHRTEDLWHPRSRHKGGRRVKLIRGRNRLWRIR
MSTSTNMRVFRLRSAWRLSQTSRLSAPRYQNQFRSVATKQASPAYPQTSSTLNQAIPNPSPSTSLAVKKLVTPIHRTEDLWHPRSRHKGGRRVKLIRGRNRLWRIR
Molecular weight: 12.29 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
6,050,972 |
41 |
7,896 |
485.4 |
54.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
8.02 |
1.21 |
5.61 |
6.21 |
3.75 |
6.4 |
2.43 |
5.54 |
4.97 |
9.09 |
2.09 |
4.03 |
4.16 |
5.6 |
6.05 |
8.32 |
6.13 |
5.98 |
1.47 |
2.95 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |