Chicken anemia virus (isolate Germany Cuxhaven-1) (CAV)
Average proteome isoelectric point is 9.06
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P69484|VP2_CAVC1 Dual specificity protein phosphatase VP2
MHGNGGQPAAGGSESALSREGQPGPSGAAQGQVISNERSPRRYSTRTINGVQATNKFTAVGNPSLQRDPDWYRWNYNHSIAVWLRECSRSHAKICNCGQFRKHWFQECAGLEDRSTQASLEEAILRPLRVQGKRAKRKLDYHYSQPTPNRKKVYKTVRWQDELADREADFTPSEEDGGTTSSDFDEDINF
DIGGDSGIVDELLGRPFTTPAPVRIV
Molecular weight: 24.14 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q99153|CAPSD_CAVC1 Capsid protein
MARRARRPRGRFYSFRRGRWHHLKRLRRRYKFRHRRRQRYRRRAFRKAFHNPRPGTYSVRLPNPQSTMTIRFQGVIFLTEGLILPKNSTAGGYADHMYGARVAKISVNLKEFLLASMNLTYVSKIGGPIAGELIADGSKSQAADNWPNCWLPLDNNVPSATPSAWWRWALMMMQPTDSCRFFNHPKQMTL
QDMGRMFGGWHLFRHIETRFQLLATKNEGSFSPVASLLSQGEYLTRRDDVKYSSDHQNRWQKGGQPMTGGIAYATGKMRPDEQQYPAMPPDPPIITATTAQGTQVRCMNSTQAWWSWDTYMSFATLTALGAQWSFPPGQRSVSRRSFNHHKARGAGDPKGQRWHTLVPLGTETITDSYMSAPASELDTNF
FTLYVAQGTNKSQQYKFGTATYALKEPVMKSDAWAVVRVQSVWQLGNRQRPYPWDVNWANSTMYWGTQP
Molecular weight: 51.72 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
786 |
121 |
449 |
262.0 |
29.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.76 |
1.4 |
4.58 |
3.94 |
3.69 |
7.38 |
2.29 |
3.56 |
4.33 |
6.23 |
2.54 |
4.2 |
5.22 |
7.38 |
9.92 |
8.02 |
7.51 |
3.94 |
2.93 |
3.18 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here