Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Average proteome isoelectric point is 6.1
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 2,844 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q8Y697|Q8Y697_LISMO Putative peptidoglycan bound protein (LPXTG motif)
MKKQRVDYKRRLDQKRAQKAKLIAALITTTTMMVAPVTVNYDSFNHQFALSGIQADAATIDLLGNSNLNTQYSNGKLVITLSGNQLVSASAVSTYYPYFELPSELSSILSNPNIRANMKIDYKIAYLGIGGIGLFNQGTVNGSSSSNFFIDSSRNAIGAKVNHLLGVGVGSVSTFTLTIDLLALGVTALP
SANDGKLDFAARTGDGLLDVDLLNSNAARGFITTDVGDADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADVDIDWRDFLVEKPTVNPIYEGTKTISGSSIYKNMNINALLKSLQSDAPVGTTFYINLTLPDGTVIGNVLIHADGTYTINI
PNYNLKAGDVIHLQVTAKYGDEVKTSDDVSVTVLPLVDSDADADADADADADADADADADGGPNPSTNGGTTGTSNGGTGVTVTNMSSNGSGTMLSSGYSADGTTSISASDLPSTGDTNSSLPWVGLGLFSLAGAFLLRLFRK
Molecular weight: 89.28 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P66248|RL34_LISMO 50S ribosomal protein L34
MKRTYQPSKRKRKKVHGFRTRMSTKNGRRVLASRRRKGRKVLSA
Molecular weight: 5.3 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,831 |
13 |
2,844 |
866,658 |
28 |
2,044 |
306.1 |
34.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.74 |
0.61 |
5.45 |
7.44 |
4.53 |
6.67 |
1.78 |
7.84 |
7.16 |
9.5 |
2.75 |
4.62 |
3.46 |
3.47 |
3.65 |
5.8 |
6.11 |
7.04 |
0.93 |
3.45 |
Note: For statistics only major isoforms were used (in this case 2,831 proteins)
For dipeptide frequency statistics click
here