Rabbit hemorrhagic disease virus (strain Rabbit/Germany/FRG/1989) (Ra/LV/RHDV/GH/1989/GE) (RHDV-FRG)
Average proteome isoelectric point is 6.95
Get precalculated fractions of proteins
| Acidic |
 |
| pI < 6.8 |
 |
| 6.8-7.4 |
 |
| pI > 7.4 |
 |
| Basic |
 |
| All |
 |
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P27410-2|POLG_RHDVF Isoform of P27410 Isoform Subgenomic capsid protein VP60 of Genome polyprotein
MEGKARAAPQGEAAGTATTASVPGTTTDGMDPGVVATTSVITAENSSASIATAGIGGPPQQVDQQETWRTNFYYNDVFTWSVADAPGSILYTVQHSPQNNPFTAVLSQMYAGWAGGMQFRFIVAGSGVFGGRLVRAVIPPGIEIGPGLEVRQFPHVVIDARSLEPVTITMPDLRPNMYHPTGDPGLVPTL
VLSVYNNLINPFGGSTSAIQVTVETRPSEDFEFVMIRAPSSKTVDSISPAGLLTTPVLTGVGNDNRWNGQIVGLQPVPGGFSTCNRHWNLNGSTYGWSSPRFGDIDHRRGSASYSGSNATNVLQFWYANAGSAIDNPISQVAPDGFPDMSFVPFNGPGIPAAGWVGFGAIWNSNSGAPNVTTVQAYELGF
ATGAPGNLQPTTNTSGAQTVAKSIYAVVTGTAQNPAGLFVMASGIISTPNASAITYTPQPDRIVTTPGTPAAAPVGKNTPIMFASVVRRTGDVNATAGSANGTQYGTGSQPLPVTIGLSLNNYSSALMPGQFFVWQLTFASGFMEIGLSVDGYFYAGTGASTTLIDLTELIDVRPVGPRPSKSTLVFNLG
GTANGFSYV
Molecular weight: 60.26 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P27412|VP2_RHDVF Protein VP2
MAFLMSEFIGLGLAGAGVLSNALLRRQELQLQKQAMENGLVLKADQLGRLGFNPNEVKNVIVGNSFSSNVRLSNMHNDASVVNAYNVYNPASNGIRKKIKSLNNSVKIYNTTGESSV
Molecular weight: 12.67 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2 |
1 |
3 |
2,461 |
117 |
2,344 |
1230.5 |
134.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.56 |
2.23 |
5.53 |
3.82 |
4.31 |
8.0 |
1.87 |
5.04 |
5.2 |
8.37 |
2.56 |
5.24 |
3.54 |
5.2 |
4.47 |
6.62 |
7.44 |
8.49 |
1.5 |
3.01 |
Note: For statistics only major isoforms were used (in this case 2 proteins)
For dipeptide frequency statistics click
here