Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>sp|P0C774|V_MEASC Non-structural protein V
MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPGQDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQASSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEI HELLKLQSRGNNFPKLGKTLNVPPPPNPSRASTSETPIKKGHRREIGLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVCEQCRTDTGVDTRIWYHNLPEIPE
Molecular weight: 32.02 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>sp|Q9YZN9|C_MEASC Protein C
MSKTDWNASGLSRPSPSAHWPSRKPWQHGQKYQTTQDRTEPPARKRRQAVRVSANHASQQLDQLKAVHLASAVRDLEKAMTTLKLWESPQEISRHQALGYSVIMFMITAVKRLRESKMLTLSWFNQALMVIAPSQEETMNLKTAMWILANLIPRDMLSLTGDLLPSLWGSGLLMLKLQKEGRSTSS
Molecular weight: 21.11 kDa Isoelectric point according different methods: